A9377
SR protein repeat Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9377
- Zusätzliche Namen:
- B52|HEL-S-91|SFRS6|SR protein repeat|SRP55
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRS
- Uniprot:
- Q13247
- Synonyme:
- B52;epididymis secretory protein Li 91;HEL-S-91;pre-mRNA-splicing factor SRP55;serine/arginine-rich splicing factor 6;SFRS6;Splicing factor, arginine/serine-rich 6;splicing factor, arginine/serine-rich, 55 kDa;SR splicing factor 6;SRP55
- Weitere Details:
- The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Alternative splicing results in multiple transcript variants. In addition, two pseudogenes, one on chromosome 17 and the other on the X chromosome, have been found for this gene.
- Versandbedingungen:
- Blue Ice