PPM1E Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9374
Zusätzliche Namen:: caMKN|CaMKP-N|CAMKPN|POPX1|PP2CH|PPM1E
Anwendung:: ELISA, WB
Molekulargewicht:: 85kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKA
Uniprot:: Q8WY54
Synonyme:: ca(2+)/calmodulin-dependent protein kinase phosphatase N;caMKN;CaMKP-N;caMKP-nucleus;CAMKPN;nuclear calmodulin-dependent protein kinase phosphatase;partner of PIX 1;partner of PIX-alpha;partner of PIXA;POPX1;PP2CH;protein phosphatase 1E;protein phosphatase 1E (PP2C domain containing)
Weitere Details:: This gene encodes a member of the PPM family of serine/threonine-protein phosphatases. The encoded protein is localized to the nucleus and dephosphorylates and inactivates multiple substrates including serine/threonine-protein kinase PAK 1, 5'-AMP-activated protein kinase (AMPK) and the multifunctional calcium/calmodulin-dependent protein kinases. Alternatively spliced transcript variants have been observed for this gene.