DCAF7 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9361
Zusätzliche Namen:: AN11|DCAF7|HAN11|SWAN-1|WDR68
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 39kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMP
Uniprot:: P61962
Synonyme:: AN11;DDB1- and CUL4-associated factor 7;HAN11;human anthocyanin;seven-WD-repeat protein of the AN11 family-1;SWAN-1;WD repeat-containing protein 68;WD repeat-containing protein An11 homolog;WDR68
Weitere Details:: This gene encodes a protein with multiple WD40 repeats which facilitate protein-protein interactions and thereby enable the assembly of multiprotein complexes. This protein has been shown to function as a scaffold protein for protein complexes involved in kinase signaling. This highly conserved gene is present in eukaryotic plants, fungi, and animals. The ortholog of this gene was first identified in plants as a key regulator of anthocyanin biosynthesis and flower pigmentation. Alternative splicing results in multiple transcript variants.