NUMB Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9352
Zusätzliche Namen:: c14_5527|C14orf41|NUMB|S171
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 71kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
Uniprot:: P49757
Synonyme:: c14_5527;C14orf41;h-Numb;numb homolog;protein numb homolog;Protein S171;S171
Weitere Details:: The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants.