A9351
DPP3 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A9351
- Zusätzliche Namen:
- DPP3|DPPIII
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA
- Uniprot:
- Q9NY33
- Synonyme:
- dipeptidyl aminopeptidase III;dipeptidyl arylamidase III;dipeptidyl peptidase 3;dipeptidyl peptidase III;DPP III;DPPIII;enkephalinase B
- Weitere Details:
- This gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice





