TXNIP Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9342
Zusätzliche Namen:: ARRDC6|EST01027|HHCPA78|THIF|TXNIP|VDUP1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 55 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEK
Uniprot:: Q9H3M7
Synonyme:: ARRDC6;EST01027;HHCPA78;THIF;thioredoxin binding protein 2;Thioredoxin-binding protein 2;thioredoxin-interacting protein;upregulated by 1,25-dihydroxyvitamin D-3;VDUP1;vitamin D3 up-regulated protein 1
Weitere Details:: This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice