MUTA Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9339
Zusätzliche Namen:: MCM|MUT|MUTA
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 83kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSA
Uniprot:: P22033
Synonyme:: MCM;methylmalonyl Coenzyme A mutase;methylmalonyl-CoA isomerase;methylmalonyl-CoA mutase c.*192delA;methylmalonyl-CoA mutase c.*51C>G;methylmalonyl-CoA mutase variant c.1495G>A;methylmalonyl-CoA mutase variant c.2011A>G;methylmalonyl-CoA mutase variant c.2150G>T;methylmalonyl-CoA mutase variant c.322C>T;methylmalonyl-CoA mutase variant c.613_615delGAA;methylmalonyl-CoA mutase variant c.636G>A;methylmalonyl-CoA mutase variant c.643G>A;methylmalonyl-CoA mutase, mitochondrial;MUT;mutant methylmalonyl CoA mutase;truncated methylmalonyl CoA mutase;truncated methylmalonyl-CoA mutase variant c.1420C>T;truncated methylmalonyl-CoA mutase variant c.2179C>T;truncated methylmalonyl-CoA mutase variant c.91C>T
Weitere Details:: This gene encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic aciduria.

Versandbedingungen:: Blue Ice