NCTR2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9320
Zusätzliche Namen:: CD336|dJ149M18.1|LY95|NCTR2|NK-p44|NKP44
Anwendung:: ELISA, WB
Molekulargewicht:: 44kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLR
Uniprot:: O95944
Synonyme:: CD336;dJ149M18.1;LY95;lymphocyte antigen 95 (activating NK-receptor; NK-p44);Lymphocyte antigen 95 homolog;lymphocyte antigen 95 homolog (activating NK-receptor; NK-p44);natural cytotoxicity triggering receptor 2;natural killer cell p44-related protein;NK cell activating receptor (NKp44);NK cell-activating receptor;NK-p44;NKP44
Weitere Details:: Predicted to enable signaling receptor activity. Predicted to be involved in cellular defense response and signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane. Predicted to be active in cell surface.