A9317
CNTN4 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A9317
- Zusätzliche Namen:
- AXCAM|BIG-2|CNTN4
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 135kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPP
- Uniprot:
- Q8IWV2
- Synonyme:
- AXCAM;axonal-associated cell adhesion molecule;BIG-2;brain-derived immunoglobulin superfamily protein 2;contactin-4;neural cell adhesion protein BIG-2
- Weitere Details:
- This gene encodes a member of the contactin family of immunoglobulins. Contactins are axon-associated cell adhesion molecules that function in neuronal network formation and plasticity. The encoded protein is a glycosylphosphatidylinositol-anchored neuronal membrane protein that may play a role in the formation of axon connections in the developing nervous system. Deletion or mutation of this gene may play a role in 3p deletion syndrome and autism spectrum disorders. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice







