A9311
PFKFB2 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A9311
- Zusätzliche Namen:
- PFK-2/FBPase-2|PFKFB2
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 54kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD
- Uniprot:
- O60825
- Synonyme:
- 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2;6PF-2-K/Fru-2,6-P2ase 2;6PF-2-K/Fru-2,6-P2ASE heart-type isozyme;fructose-2,6-bisphosphatase, cardiac isozyme;PFK-2/FBPase-2;PFK/FBPase 2;PFKFB, cardiac
- Weitere Details:
- The protein encoded by this gene is involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate, and a fructose-2,6-biphosphatase activity that catalyzes the degradation of fructose-2,6-bisphosphate. This protein regulates fructose-2,6-bisphosphate levels in the heart, while a related enzyme encoded by a different gene regulates fructose-2,6-bisphosphate levels in the liver and muscle. This enzyme functions as a homodimer. Two transcript variants encoding two different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice





