STXBP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9309
Zusätzliche Namen:: DEE4|MUNC18-1|N-Sec1|NSEC1|P67|RBSEC1|STXBP1|unc-18A|UNC18|unc18-1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 70 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: STYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYP
Uniprot:: P61764
Synonyme:: DEE4;MUNC18-1;N-Sec1;neuronal SEC1;NSEC1;P67;protein unc-18 homolog 1;protein unc-18 homolog A;RBSEC1;syntaxin-binding protein 1;unc-18A;UNC18;unc18-1
Weitere Details:: This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.