CORO1A Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9300
Zusätzliche Namen:: CLABP|CLIPINA|CORO1A|HCORO1|IMD8|p57|TACO
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 51kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Uniprot:: P31146
Synonyme:: CLABP;clipin-A;CLIPINA;coronin-1;coronin-1A;coronin-like protein A;coronin-like protein p57;coronin, actin binding protein, 1A;HCORO1;IMD8;p57;TACO;tryptophan aspartate-containing coat protein
Weitere Details:: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16.