METTL4 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9294
Zusätzliche Namen:: HsT661|METTL4
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 54kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
ABP:: No Import Docs
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPIT
Uniprot:: Q8N3J2
Synonyme:: HsT661;methyltransferase like 4;methyltransferase-like protein 4;N(6)-adenine-specific DNA methyltransferase METTL4;N(6)-adenine-specific methyltransferase METTL4;snRNA (2'-O-methyladenosine-N(6)-)-methyltransferase METTL4
Weitere Details:: Enables RNA methyltransferase activity and site-specific DNA-methyltransferase (adenine-specific) activity. Involved in nucleic acid metabolic process; regulation of RNA metabolic process; and regulation of mitochondrial DNA replication. Located in cytosol; mitochondrial matrix; and nucleus.