VPS35 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9278
Zusätzliche Namen:: MEM3|PARK17|VPS35
Anwendung:: ELISA, WB
Molekulargewicht:: 92kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQ
Uniprot:: Q96QK1
Synonyme:: hVPS35;maternal-embryonic 3;MEM3;PARK17;vacuolar protein sorting 35 homolog;vacuolar protein sorting-associated protein 35;Vesicle protein sorting 35
Weitere Details:: This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex.