A9274
Somatostatin (SST) Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A9274
- Zusätzliche Namen:
- SMST|Somatostatin (SST)|SST1
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 13kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
- Uniprot:
- P61278
- Synonyme:
- growth hormone release-inhibiting factor;prepro-somatostatin;SMST;somatostatin;somatostatin-14;somatostatin-28;SST1
- Weitere Details:
- The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.
- Versandbedingungen:
- Blue Ice







