FOXO3A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9270
Zusätzliche Namen:: AF6q21|FKHRL1|FKHRL1P2|FOXO2|FOXO3A
Anwendung:: ELISA, WB
Molekulargewicht:: 90kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
Uniprot:: O43524
Synonyme:: AF6q21;AF6q21 protein;FKHRL1;FKHRL1P2;forkhead box O3A;forkhead box protein O3;forkhead homolog (rhabdomyosarcoma) like 1;forkhead in rhabdomyosarcoma-like 1;forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1;FOXO2;FOXO3A;FOXO3A-
Weitere Details:: This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.