KDM4A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9267
Zusätzliche Namen:: JHDM3A|JMJD2|JMJD2A|KDM4A|TDRD14A
Anwendung:: ELISA, WB
Molekulargewicht:: 150kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPN
Uniprot:: O75164
Synonyme:: [histone H3]-trimethyl-L-lysine(36) demethylase 4A;[histone H3]-trimethyl-L-lysine(9) demethylase 4A;JHDM3A;jmjC domain-containing histone demethylation protein 3A;JMJD2;JMJD2A;jumonji C domain-containing histone demethylase 3A;jumonji domain containing 2;jumonji domain containing 2A;jumonji domain-containing protein 2A;lysine (K)-specific demethylase 4A;lysine-specific demethylase 4A;TDRD14A;tudor domain containing 14A
Weitere Details:: This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor.