USP22 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9261
Zusätzliche Namen:: USP22|USP3L
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKSCICHVCGVHLNRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGL
Uniprot:: Q9UPT9
Synonyme:: deubiquitinating enzyme 22;ubiquitin carboxyl-terminal hydrolase 22;ubiquitin specific protease 22;ubiquitin thioesterase 22;ubiquitin thiolesterase 22;ubiquitin-specific processing protease 22;Ubiquitin-specific-processing protease 22;USP3L
Weitere Details:: Enables enzyme binding activity; nuclear receptor coactivator activity; and thiol-dependent deubiquitinase. Contributes to H4 histone acetyltransferase activity. Involved in positive regulation of mitotic cell cycle; positive regulation of transcription, DNA-templated; and protein modification by small protein conjugation or removal. Part of SAGA complex.