MCM4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9251
Zusätzliche Namen:: CDC21|CDC54|hCdc21|IMD54|MCM4|NKCD|NKGCD|P1-CDC21
Anwendung:: ELISA, WB
Molekulargewicht:: 97kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVRLL
Uniprot:: P33991
Synonyme:: CDC21;CDC21 homolog;CDC54;DNA replication licensing factor MCM4;hCdc21;homolog of S. pombe cell devision cycle 21;IMD54;minichromosome maintenance deficient 4;NKCD;NKGCD;P1-CDC21
Weitere Details:: The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported.

Versandbedingungen:: Blue Ice