SETD7 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9225
Zusätzliche Namen:: KMT7|SET7|SET7/9|SET9|SETD7
Anwendung:: ELISA, WB
Molekulargewicht:: 48 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDT
Uniprot:: Q8WTS6
Synonyme:: H3-K4-HMTase SETD7;histone H3-K4 methyltransferase SETD7;histone H3-lysine 4-specific methyltransferase;histone-lysine N-methyltransferase SETD7;KMT7;lysine N-methyltransferase 7;SET domain containing 7, lysine methyltransferase;SET domain containing lysine methyltransferase 7;SET domain-containing protein 7;SET7;SET7/9;SET9
Weitere Details:: Enables histone-lysine N-methyltransferase activity and p53 binding activity. Involved in peptidyl-lysine dimethylation and peptidyl-lysine monomethylation. Acts upstream of or within cellular response to DNA damage stimulus and heterochromatin organization. Located in chromosome and nucleolus.