A9215
RAB11FIP1 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9215
- Zusätzliche Namen:
- NOEL1A|rab11-FIP1|RAB11FIP1|RCP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EAKGEIKDSSPSSSPSPKGFRKKHLFSSTENLAAGSWKEPAEGGGLSSDRQLSESSTKDSLKSMTLPSYRPAPLVSGDLRENMAPANSEATKEAKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDVQITEPEAEPESKSEPRPPISSPRAPQTRAVKP
- Uniprot:
- Q6WKZ4
- Synonyme:
- NOEL1A;Rab effector protein;Rab-coupling protein;Rab-interacting recycling protein;RAB11 coupling protein;RAB11 family interacting protein 1 (class I);rab11 family-interacting protein 1;rab11-FIP1;RCP
- Weitere Details:
- This gene encodes one of the Rab11-family interacting proteins (Rab11-FIPs), which play a role in the Rab-11 mediated recycling of vesicles. The encoded protein may be involved in endocytic sorting, trafficking of proteins including integrin subunits and epidermal growth factor receptor (EGFR), and transport between the recycling endosome and the trans-Golgi network. Alternative splicing results in multiple transcript variants. A pseudogene is described on the X chromosome.
- Versandbedingungen:
- Blue Ice