FGFR4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9197
Zusätzliche Namen:: CD334|FGFR4|JTK2|TKF
Anwendung:: ELISA, WB
Molekulargewicht:: 95 kDa/125 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT
Uniprot:: P22455
Synonyme:: CD334;fibroblast growth factor receptor 4;hydroxyaryl-protein kinase;JTK2;protein-tyrosine kinase;TKF;tyrosine kinase related to fibroblast growth factor receptor;tyrosylprotein kinase
Weitere Details:: The protein encoded by this gene is a tyrosine kinase and cell surface receptor for fibroblast growth factors. The encoded protein is involved in the regulation of several pathways, including cell proliferation, cell differentiation, cell migration, lipid metabolism, bile acid biosynthesis, vitamin D metabolism, glucose uptake, and phosphate homeostasis. This protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment, and a cytoplasmic tyrosine kinase domain. The extracellular portion interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation.

Versandbedingungen:: Blue Ice