A9182
PSMA2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A9182
- Zusätzliche Namen:
- HC3|MU|PMSA2|PSC2|PSMA2
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLV
- Uniprot:
- P25787
- Synonyme:
- HC3;macropain subunit C3;MU;multicatalytic endopeptidase complex subunit C3;PMSA2;proteasome (prosome, macropain) subunit, alpha type, 2;proteasome component C3;proteasome subunit alpha 2;proteasome subunit alpha type-2;proteasome subunit HC3;PSC2
- Weitere Details:
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
- Versandbedingungen:
- Blue Ice







