MYL12A Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9176
Zusätzliche Namen:: HEL-S-24|MLC-2B|MLCB|MRCL3|MRLC3|MYL12A|MYL2B
Anwendung:: ELISA, WB
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Uniprot:: P19105
Synonyme:: epididymis secretory protein Li 24;HEL-S-24;MLC-2B;MLCB;MRCL3;MRLC3;MYL2B;myosin regulatory light chain 12A;myosin regulatory light chain 2, nonsarcomeric;myosin regulatory light chain 3;myosin regulatory light chain MRLC3;myosin RLC;myosin, light chain 12A, regulatory, non-sarcomeric;myosin, light polypeptide, regulatory, non-sarcomeric (20kD)
Weitere Details:: This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.