HMGB2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9168
Zusätzliche Namen:: HMG2|HMGB2
Anwendung:: ChIP, ELISA, WB, IHC-P, IF, ICC, IP, FuncS
Molekulargewicht:: 24 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPS
Uniprot:: P26583
Synonyme:: high mobility group protein 2;high mobility group protein B2;high-mobility group (nonhistone chromosomal) protein 2;HMG-2;HMG2
Weitere Details:: This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.