GRK3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9163
Zusätzliche Namen:: ADRBK2|BARK2|GRK3
Anwendung:: ELISA, WB
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVELPKPSLCHRNSNGL
Uniprot:: P35626
Synonyme:: ADRBK2;adrenergic, beta, receptor kinase 2;BARK2;beta-adrenergic receptor kinase 2;beta-ARK-2;G-protein-coupled receptor kinase 3
Weitere Details:: The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.