A9150
MED4 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9150
- Zusätzliche Namen:
- ARC36|DRIP36|HSPC126|MED4|TRAP36|VDRIP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 36kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD
- Uniprot:
- Q9NPJ6
- Synonyme:
- activator-recruited cofactor 36 kDa component;ARC36;DRIP36;HSPC126;Mediator complex subunit 4;mediator of RNA polymerase II transcription subunit 4;mediator, 34-kD subunit, homolog;TRAP/SMCC/PC2 subunit p36 subunit;TRAP36;VDRIP;vitamin D receptor-interacting protein, 36-kD;vitamin D3 receptor-interacting protein complex 36 kDa component
- Weitere Details:
- This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice