Carbonic Anhydrase 2 (CA2) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9148
Zusätzliche Namen:: CA-II|CAC|CAII|Car2|Carbonic Anhydrase 2 (CA2)|HEL-76|HEL-S-282
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 29kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Uniprot:: P00918
Synonyme:: CA-II;CAC;CAII;Car2;carbonate dehydratase II;carbonic anhydrase 2;carbonic anhydrase B;carbonic anhydrase C;carbonic anhydrase II;carbonic dehydratase;epididymis luminal protein 76;epididymis secretory protein Li 282;HEL-76;HEL-S-282
Weitere Details:: The protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene.