Prohibitin 2 (PHB2) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9144
Zusätzliche Namen:: BAP|Bap37|BCAP37|hBAP|p22|PNAS-141|Prohibitin 2 (PHB2)|REA
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 33kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAK
Uniprot:: Q99623
Synonyme:: B cell receptor associated protein 37;B-cell associated protein;B-cell receptor-associated protein BAP37;BAP;Bap37;BCAP37;D-prohibitin;hBAP;p22;PNAS-141;prohibitin-2;REA;repressor of estrogen receptor activity
Weitere Details:: Enables several functions, including protein C-terminus binding activity; protein N-terminus binding activity; and protein dimerization activity. Involved in several processes, including defense response to virus; positive regulation of cell cycle phase transition; and regulation of transcription, DNA-templated. Located in several cellular components, including cell surface; mitochondrial membrane; and nuclear matrix. Part of mitochondrial prohibitin complex.