A9127
CLPP Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A9127
- Zusätzliche Namen:
- CLPP|DFNB81|PRLTS3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
- Uniprot:
- Q16740
- Synonyme:
- ATP-dependent Clp protease proteolytic subunit, mitochondrial;ATP-dependent protease ClpAP, proteolytic subunit, human;ClpP caseinolytic peptidase ATP-dependent, proteolytic subunit;ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog;ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog;DFNB81;endopeptidase Clp;PRLTS3;putative ATP-dependent Clp protease proteolytic subunit, mitochondrial
- Weitere Details:
- The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.
- Versandbedingungen:
- Blue Ice



