ALDH1A2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9123
Zusätzliche Namen:: ALDH1A2|DIH4|RALDH(II)|RALDH2|RALDH2-T
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 57kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDAS
Uniprot:: O94788
Synonyme:: Aldehyde dehydrogenase family 1 member A2;RALDH 2;RALDH(II);RALDH2;RALDH2-T;retinal dehydrogenase 2;retinaldehyde-specific dehydrogenase type 2
Weitere Details:: This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene.