A9105
TARBP2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9105
- Zusätzliche Namen:
- LOQS|TARBP2|TRBP|TRBP1|TRBP2
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE
- Uniprot:
- Q15633
- Synonyme:
- LOQS;RISC-loading complex subunit TARBP2;TAR (HIV-1) RNA binding protein 2;TAR (HIV) RNA-binding protein 2;TAR (HIV) RNA-binding protein TRBP1;TAR RNA binding protein 2;TAR RNA-binding protein 2;TARBP2, RISC loading complex RNA binding subunit;trans-activation responsive RNA-binding protein;Trans-activation-responsive RNA-binding protein;TRBP;TRBP1;TRBP2
- Weitere Details:
- HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene.
- Versandbedingungen:
- Blue Ice