ASS1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9084
Zusätzliche Namen:: ASS|ASS1|CTLN1
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 47 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIAR
Uniprot:: P00966
Synonyme:: argininosuccinate synthase;argininosuccinate synthetase 1;ASS;Citrulline--aspartate ligase;citrulline-aspartate ligase;CTLN1;epididymis secretory sperm binding protein
Weitere Details:: The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.