FKBP1B Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9074
Zusätzliche Namen:: FKBP12.6|FKBP1B|FKBP1L|OTK4|PKBP1L|PPIase
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 13kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Uniprot:: P68106
Synonyme:: 12.6 kDa FK506-binding protein;12.6 kDa FKBP;calstabin 2;FK506 binding protein 1B, 12.6 kDa;FK506-binding protein 12.6;FK506-binding protein 1B;FKBP-12.6;FKBP-1B;FKBP12.6;FKBP1L;h-FKBP-12;immunophilin FKBP12.6;OTK4;peptidyl-prolyl cis-trans isomerase FKBP1B;PKBP1L;PPIase;PPIase FKBP1B;rotamase
Weitere Details:: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.