POMP Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9067
Zusätzliche Namen:: C13orf12|HSPC014|PNAS-110|POMP|PRAAS2|UMP1
Anwendung:: ELISA, WB
Molekulargewicht:: 16kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL
Uniprot:: Q9Y244
Synonyme:: 2510048O06Rik;C13orf12;HSPC014;hUMP1;PNAS-110;PRAAS2;proteasome maturation protein;proteassemblin;protein UMP1 homolog;UMP1;voltage-gated K channel beta subunit 4.1;voltage-gated potassium channel beta subunit 4.1
Weitere Details:: The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.