DDOST Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9056
Zusätzliche Namen:: AGER1|CDG1R|DDOST|GATD6|OKSWcl45|OST|OST48|WBP1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 48kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VCASGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVF
Uniprot:: P39656
Synonyme:: advanced glycation end-product receptor 1;advanced glycation endproduct receptor 1;AGER1;CDG1R;dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit;dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic);dolichyl-diphosphooligosaccharide-protein glycotransferase;GATD6;OKSWcl45;oligosaccharyl transferase 48 kDa subunit;oligosaccharyltransferase 48 kDa subunit;oligosaccharyltransferase subunit 48;OST;OST48;WBP1
Weitere Details:: This gene encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia.

Versandbedingungen:: Blue Ice