SUMO4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9016
Zusätzliche Namen:: dJ281H8.4|IDDM5|SMT3H4|SUMO-4|SUMO4
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Uniprot:: Q6EEV6
Synonyme:: dJ281H8.4;IDDM5;insulin-dependent diabetes mellitus 5;small ubiquitin-like modifier 4 protein;Small ubiquitin-like protein 4;small ubiquitin-related modifier 4;SMT3 suppressor of mif two 3 homolog 2;SMT3 suppressor of mif two 3 homolog 4;SMT3H4;SUMO-4
Weitere Details:: This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism.