APOBEC3B Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9010
Zusätzliche Namen:: A3B|APOBEC1L|APOBEC3B|ARCD3|ARP4|bK150C2.2|DJ742C19.2|PHRBNL
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa/46kDa/70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFY
Uniprot:: Q9UH17
Synonyme:: A3B;APOBEC1L;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B;ARCD3;ARP4;bK150C2.2;cytidine deaminase;DJ742C19.2;DNA dC->dU-editing enzyme APOBEC-3B;phorbolin 2;phorbolin 3;phorbolin-1-related protein;phorbolin-2/3;PHRBNL;probable DNA dC->dU-editing enzyme APOBEC-3B
Weitere Details:: This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. A hybrid gene results from the deletion of approximately 29.5 kb of sequence between this gene, APOBEC3B, and the adjacent gene APOBEC3A. The breakpoints of the deletion are within the two genes, so the deletion allele is predicted to have the promoter and coding region of APOBEC3A, but the 3' UTR of APOBEC3B. Two transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice