Periostin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9009
Zusätzliche Namen:: OSF-2|OSF2|PDLPOSTN|Periostin|PN
Anwendung:: ELISA, WB
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDH
Uniprot:: Q15063
Synonyme:: OSF-2;OSF2;osteoblast specific factor 2 (fasciclin I-like);Osteoblast-specific factor 2;PDLPOSTN;periodontal ligament-specific periostin;periostin;periostin, osteoblast specific factor;PN
Weitere Details:: This gene encodes a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesion and migration of epithelial cells. This protein plays a role in cancer stem cell maintenance and metastasis. Mice lacking this gene exhibit cardiac valve disease, and skeletal and dental defects. Alternative splicing results in multiple transcript variants encoding different isoforms.