A9006
TCF7L1 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A9006
- Zusätzliche Namen:
- TCF-3|TCF3|TCF7L1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEE
- Uniprot:
- Q9HCS4
- Synonyme:
- HMG box transcription factor 3;TCF-3;TCF3;transcription factor 7-like 1;transcription factor 7-like 1 (T-cell specific, HMG-box)
- Weitere Details:
- This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor beta signaling pathway. The encoded protein contains a high mobility group-box DNA binding domain and participates in the regulation of cell cycle genes and cellular senescence.
- Versandbedingungen:
- Blue Ice

