A9005
FAT10/UBD Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9005
- Zusätzliche Namen:
- FAT10|FAT10/UBD|GABBR1|UBD-3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 22 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGI
- Uniprot:
- O15205
- Synonyme:
- diubiquitin;FAT10;GABBR1;UBD-3;ubiquitin D;ubiquitin-like protein FAT10
- Weitere Details:
- This gene encodes a protein which contains two ubiquitin-like domains and appears to have similar function to ubiquitin. Through covalent attachment, the encoded protein targets other proteins for 26S proteasome degradation. This protein has been implicated to function in many cellular processes, including caspase-dependent apoptosis, formation of aggresomes, mitotic regulation, and dendritic cell maturation. Upregulation of this gene may promote inflammation in chronic kidney disease and has been observed in many cancer types.
- Versandbedingungen:
- Blue Ice