[KO Validated] SUCLG2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A8976
Zusätzliche Namen:: G-SCS|G2|GBETA|GTPSCS
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 47kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLD
Uniprot:: Q96I99
Synonyme:: G-SCS;GBETA;GTP-specific succinyl-CoA synthetase beta subunit;GTP-specific succinyl-CoA synthetase subunit beta;GTPSCS;SCS-betaG;succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial;succinate-CoA ligase GDP-forming beta subunit;succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial;succinyl-CoA ligase, GDP-forming, beta chain, mitochondrial;Succinyl-CoA synthetase beta-G chain;succinyl-CoA synthetase, beta-G chain
Weitere Details:: This gene encodes a GTP-specific beta subunit of succinyl-CoA synthetase. Succinyl-CoA synthetase catalyzes the reversible reaction involving the formation of succinyl-CoA and succinate. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 5 and 12.

Versandbedingungen:: Blue Ice