A8970
NUP153 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A8970
- Zusätzliche Namen:
- HNUP153|N153|NUP153
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 154kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMR
- Uniprot:
- P49790
- Synonyme:
- 153 kDa nucleoporin;HNUP153;N153;nuclear pore complex protein hnup153;nuclear pore complex protein Nup153;nucleoporin 153kD;nucleoporin 153kDa;nucleoporin Nup153
- Weitere Details:
- Nuclear pore complexes regulate the transport of macromolecules between the nucleus and cytoplasm. They are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. Nucleoporins are glycoproteins found in nuclear pores and contain characteristic pentapeptide XFXFG repeats as well as O-linked N-acetylglucosamine residues oriented towards the cytoplasm. The protein encoded by this gene has three distinct domains: a N-terminal region containing a pore targeting and an RNA-binding domain domain, a central region containing multiple zinc finger motifs, and a C-terminal region containing multiple XFXFG repeats. Alternative splicing results in multiple transcript variants of this gene.
- Versandbedingungen:
- Blue Ice

