A8958
hnRNP C Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A8958
- Zusätzliche Namen:
- C1|C2|HNRNP|hnRNP C|HNRPC|SNRPC
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 36-40 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGK
- Uniprot:
- P07910
- Synonyme:
- C1;C2;heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoproteins C1/C2;HNRNP;hnRNP C1/C2;HNRPC;nuclear ribonucleoprotein particle C1 protein;nuclear ribonucleoprotein particle C2 protein;SNRPC
- Weitere Details:
- This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene.
- Versandbedingungen:
- Blue Ice