A8953
Neutrophil Elastase (ELANE) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A8953
- Zusätzliche Namen:
- ELA2|GE|HLE|HNE|NE|Neutrophil Elastase (ELANE)|PMN-E|SCN1
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 35 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
- Uniprot:
- P08246
- Synonyme:
- bone marrow serine protease;ELA2;elastase 2, neutrophil;elastase-2;GE;granulocyte-derived elastase;HLE;HNE;Human leukocyte elastase;leukocyte elastase;medullasin;NE;neutrophil elastase;PMN elastase;PMN-E;polymorphonuclear elastase;polymorphonuclear leukocyte elastase;SCN1
- Weitere Details:
- Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode structurally similar proteins. The encoded preproprotein is proteolytically processed to generate the active protease. Following activation, this protease hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix. The enzyme may play a role in degenerative and inflammatory diseases through proteolysis of collagen-IV and elastin. This protein also degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is present in a gene cluster on chromosome 19.
- Versandbedingungen:
- Blue Ice