CXCR5 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A8950
Zusätzliche Namen:: BLR1|CD185|CXCR5|MDR15
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 42 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF
Uniprot:: P32302
Synonyme:: BLR1;Burkitt lymphoma receptor 1;Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif) receptor 5);Burkitt lymphoma receptor 1, GTP-binding protein;C-X-C chemokine receptor type 5;CD185;chemokine (C-X-C motif) receptor 5;CXC-R5;CXCR-5;MDR-15;MDR15;monocyte-derived receptor 15
Weitere Details:: This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.