A8939
ACTN2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A8939
- Zusätzliche Namen:
- ACTN2|CMD1AA|CMH23|CMYP8|MPD6|MYOCOZ
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 104kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANV
- Uniprot:
- P35609
- Synonyme:
- alpha-actinin skeletal muscle;Alpha-actinin skeletal muscle isoform 2;alpha-actinin-2;CMD1AA;CMH23;F-actin cross-linking protein;MPD6;MYOCOZ;truncated actinin alpha 2
- Weitere Details:
- Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles. Several transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice