A8930
PDK1/PDHK1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A8930
- Zusätzliche Namen:
- PDK1|PDK1/PDHK1|pyruvate dehydrogenase kinase 1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 49kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
- Uniprot:
- Q15118
- Synonyme:
- [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial;mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1;PDH kinase 1;pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 1, mitochondrial;Pyruvate dehydrogenase kinase isoform 1;pyruvate dehydrogenase kinase, isoenzyme 1
- Weitere Details:
- Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice