A8912
Glycogen synthase 1 (GYS1) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A8912
- Zusätzliche Namen:
- Glycogen synthase 1 (GYS1)|GSY|GYS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 85kDa/84 kDa/84 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN
- Uniprot:
- P13807
- Synonyme:
- glycogen [starch] synthase, muscle;glycogen synthase 1 (muscle);GSY;GYS
- Weitere Details:
- The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1,4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice