A8909
MARVELD2 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A8909
- Zusätzliche Namen:
- DFNB49|MARVD2|MARVELD2|MRVLDC2|Tric
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 64kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
- Uniprot:
- Q8N4S9
- Synonyme:
- DFNB49;MARVD2;MARVEL (membrane-associating) domain containing 2;MARVEL domain-containing protein 2;MRVLDC2;Tric;tricellulin
- Weitere Details:
- The protein encoded by this gene is a membrane protein found at the tight junctions between epithelial cells. The encoded protein helps establish epithelial barriers such as those in the organ of Corti, where these barriers are required for normal hearing. Defects in this gene are a cause of deafness autosomal recessive type 49 (DFNB49). Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

